PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_10667A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family Nin-like
Protein Properties Length: 342aa    MW: 36689.9 Da    PI: 4.8535
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_10667AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK67.71.8e-21291337248
                     RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                                +k+++l+d+s+yF+lp+++A+keLgvc+TvLK   R +GI+RWPhRk
  Oropetium_20150105_10667A 291 TKKLELHDISRYFHLPMAKACKELGVCATVLKGLRRTFGIERWPHRK 337
                                799*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.198281341IPR003035RWP-RK domain
PfamPF020424.3E-18294338IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MAANGGDNNN HGYYEGQWPF DPLNMVPGDF DDDVIHLLDV PGGLYSPPAA PPPLQNVVGN  60
NCSYGGDPLD LVPVPGSNDT SAPQAAGGGT PAMAGPSTSA HRQDDDASSS YVHQGAQLDC  120
TGCQILREVM HTNGFETTKF CIHGAAAQFY HATVEVYHAN PDGFALAPTH QFFVDFMDRD  180
YAWVKHYLMV YAQHRAAGGC TVVHDSTSDF IDALCTTMPG GALLEDRREA PAQAAEAETG  240
AEVSAASAGD DVVKPIIIGQ EEMPLEESPV HIKDATFNVN STEVPANRER TKKLELHDIS  300
RYFHLPMAKA CKELGVCATV LKGLRRTFGI ERWPHRKSAG L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP80552944
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.13e-10RWP-RK domain-containing protein